Welcome to our store Learn more

New collections added! Learn more

Custom proteins

Custom Antibodies

CUSTOM
Gentaur  |  SKU: 0197-STA-2368

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg

$2,249.00 USD
Tax included Shipping calculated at checkout.

Size

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg - 1 kit is backordered and will ship as soon as it is back in stock.


Care information

Display general product information or specific product information using metafields.

Delivery and Shipping

Add some general information about your delivery and shipping policies.

Add a stand out message for your customers

Highlight title

Text to highlight a key feature of your product

Description

The MSDS of FVNQHLSGSHLVEALYLVSGERGFFYTPKA for Synthetic is available from Karlan upon request.

Payment & Security

Payment methods

  • American Express
  • Apple Pay
  • Bancontact
  • Google Pay
  • iDEAL
  • Maestro
  • Mastercard
  • Shop Pay
  • Union Pay
  • Visa

Your payment information is processed securely. We do not store credit card details nor have access to your credit card information.

Product features

Use this section to highlight specific product features to your customers.

Product comparison grid

Add content here to explain a bit about the range of products on offer and which ones may be most suitable for your customers.

A table comparing the facets of 4 products
Facet
Product title
View details
Product title
View details
Product title
View details
Product title
View details
By
ByProduct vendorProduct vendorProduct vendorProduct vendor
Price
Price
$999.99
$999.99
$999.99
$999.99
Description
DescriptionA description of the product, including details such as build quality, materials used and reasons to purchase.A description of the product, including details such as build quality, materials used and reasons to purchase.A description of the product, including details such as build quality, materials used and reasons to purchase.A description of the product, including details such as build quality, materials used and reasons to purchase.

Image banner

Share information about your brand with your customers. Describe a product, make announcements, or welcome customers to your store.

Gentaur

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg

$2,249.00 USD

The MSDS of FVNQHLSGSHLVEALYLVSGERGFFYTPKA for Synthetic is available from Karlan upon request.

Size

  • 1 kit
View product