Passer aux informations produits
1 de 1

Gentaur

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg

Prix habituel $2,249.00 USD
Prix habituel Prix promotionnel $2,249.00 USD
En vente Épuisé
Taxes incluses. Frais d'expédition calculés à l'étape de paiement.
Size

The MSDS of FVNQHLSGSHLVEALYLVSGERGFFYTPKA for Synthetic is available from Karlan upon request.

Afficher tous les détails