Gentaur
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg
Prix habituel
$2,249.00 USD
Prix habituel
Prix promotionnel
$2,249.00 USD
Prix unitaire
par
Taxes incluses.
Frais d'expédition calculés à l'étape de paiement.
Impossible de charger la disponibilité du service de retrait
The MSDS of FVNQHLSGSHLVEALYLVSGERGFFYTPKA for Synthetic is available from Karlan upon request.
