Welcome to our store Learn more

New collections added! Learn more

Custom proteins

Custom Antibodies

CUSTOM
Gentaur  |  SKU: 0197-STA-2368

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg

$2,249.00 USD
inkl. MwSt. Versand wird beim Checkout berechnet.

Size

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg - 1 kit ist auf Lager und wird versandt, sobald es wieder verfügbar ist


Care information

Display general product information or specific product information using metafields.

Delivery and Shipping

Add some general information about your delivery and shipping policies.

Add a stand out message for your customers

Highlight title

Text to highlight a key feature of your product

Beschreibung

The MSDS of FVNQHLSGSHLVEALYLVSGERGFFYTPKA for Synthetic is available from Karlan upon request.

Payment & Security

Payment methods

  • American Express
  • Apple Pay
  • Google Pay
  • Maestro
  • Mastercard
  • PayPal
  • Shop Pay
  • Union Pay
  • Visa

Your payment information is processed securely. We do not store credit card details nor have access to your credit card information.

Product features

Use this section to highlight specific product features to your customers.

Product comparison grid

Add content here to explain a bit about the range of products on offer and which ones may be most suitable for your customers.

Eine Tabelle zum Vergleich von 4 Produkten
Produktfacette
Beispiel für Produkttitel
Alle Einzelheiten
Beispiel für Produkttitel
Alle Einzelheiten
Beispiel für Produkttitel
Alle Einzelheiten
Beispiel für Produkttitel
Alle Einzelheiten
Anbieter
AnbieterAnbieterAnbieterAnbieterAnbieter
Preis
Preis
$999.99
$999.99
$999.99
$999.99
Beschreibung
BeschreibungEine Beschreibung des Produkts, einschließlich Details wie Verarbeitungsqualität, verwendete Materialien und Kaufgründe.Eine Beschreibung des Produkts, einschließlich Details wie Verarbeitungsqualität, verwendete Materialien und Kaufgründe.Eine Beschreibung des Produkts, einschließlich Details wie Verarbeitungsqualität, verwendete Materialien und Kaufgründe.Eine Beschreibung des Produkts, einschließlich Details wie Verarbeitungsqualität, verwendete Materialien und Kaufgründe.

Our Collections

Image banner

Share information about your brand with your customers. Describe a product, make announcements, or welcome customers to your store.

Gentaur

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg

$2,249.00 USD

The MSDS of FVNQHLSGSHLVEALYLVSGERGFFYTPKA for Synthetic is available from Karlan upon request.

Size

  • 1 kit
Produkt anzeigen