Gentaur
FN1 (Fibronectina) mouse, ELISA, 96 test
$1,041.00 USDGrundpreis /Nicht verfügbarAuf LagerGentaur
Foam Dewar Bundle 1800mL 1400mL 800mL 500mL
$870.00 USDGrundpreis /Nicht verfügbarAuf LagerGentaur
Foot and mouth disease virus OneStep PCR kit, 100 reactions
$1,641.00 USDGrundpreis /Nicht verfügbarAuf LagerGentaur
Fructosyl-amino acid oxidase from Microorganism, > 3 u/mg - 5KU
$1,459.00 USDGrundpreis /Nicht verfügbarAuf LagerGentaur
FTL elisa antibody pair :: Ferritin light chain ELISA Antibody Pair - 5 Plates
$450.00 USDGrundpreis /Nicht verfügbarAuf LagerGentaur
Fungigone, Fungal Contamination Inhibitor 100ml 100x
$109.00 USDGrundpreis /Nicht verfügbarAuf LagerGentaur
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg
$2,249.00 USDGrundpreis /Nicht verfügbarAuf LagerGentaur
G-1-GPR30 agonist, potent and selective-10mg
$267.00 USDGrundpreis /Nicht verfügbarAuf LagerGentaur
G0S2 Antibody Primary Rabbit Polyclonal - 200ul
$565.00 USDGrundpreis /Nicht verfügbarAuf LagerGentaur
Galanthus nivalis Lectin (GNL/GNA) Separopore® 4B - 50 mL
$4,263.00 USDGrundpreis /Nicht verfügbarAuf Lager